PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013607014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 858aa    MW: 95946.7 Da    PI: 5.5418
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013607014.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.66.1e-183783148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEde+l +av+ + g++Wk+Ia+ +   Rt+ qc +rwqk+l
   XP_013607014.1 37 RGQWTAEEDEILTKAVHSFKGKNWKKIAEFFK-DRTDVQCLHRWQKVL 83
                     89*****************************9.************986 PP

2Myb_DNA-binding636.1e-2089135148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+WT+eEde +v++++++G++ W+tIar ++ gR +kqc++rw+++l
   XP_013607014.1  89 KGPWTKEEDEMIVQLIQKYGPKKWSTIARFLP-GRIGKQCRERWHNHL 135
                      79******************************.*************97 PP

3Myb_DNA-binding45.61.6e-14141183145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ll++a++ +G++ W+   + ++ gR+++ +k++w+
   XP_013607014.1 141 KEAWTQEEELLLIRAHQIYGNR-WAELTKFLP-GRSDNGIKNHWH 183
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.6733283IPR017930Myb domain
SMARTSM007174.6E-153685IPR001005SANT/Myb domain
PfamPF002491.5E-153783IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-223891IPR009057Homeodomain-like
SuperFamilySSF466892.3E-153893IPR009057Homeodomain-like
CDDcd001671.07E-134083No hitNo description
PROSITE profilePS5129432.29784139IPR017930Myb domain
SuperFamilySSF466895.87E-3286182IPR009057Homeodomain-like
SMARTSM007175.1E-1988137IPR001005SANT/Myb domain
PfamPF002499.2E-1889135IPR001005SANT/Myb domain
CDDcd001674.98E-1791135No hitNo description
Gene3DG3DSA:1.10.10.601.8E-2792139IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.1E-20140190IPR009057Homeodomain-like
PROSITE profilePS5129418.591140190IPR017930Myb domain
SMARTSM007171.4E-13140188IPR001005SANT/Myb domain
PfamPF002498.1E-13141183IPR001005SANT/Myb domain
CDDcd001678.87E-11143183No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 858 aa     Download sequence    Send to blast
MESECTTTSS TPPQRVTEGN PKSRQGRTSG PARRSTRGQW TAEEDEILTK AVHSFKGKNW  60
KKIAEFFKDR TDVQCLHRWQ KVLNPELVKG PWTKEEDEMI VQLIQKYGPK KWSTIARFLP  120
GRIGKQCRER WHNHLNPAIN KEAWTQEEEL LLIRAHQIYG NRWAELTKFL PGRSDNGIKN  180
HWHSSVKKKL DSYMSSGLLD QYQAMPLAPY DRNSFMQSTM DGSGCVSGQA EQEIEHGIMN  240
MGQHFHPCEN SQYYYPELED ISVSISEASY DMEDCSQFPD HNVSASTSQD YQFDFQDLSD  300
ISLEMSQNMS GLPMTYTKER KEASLGAPNS KSNIDVAAYT NTSETECCRV LFLDQESEGV  360
SVSRSSTQEP HEVLCASASD SQVSEATKSP MKSSSSMSIA TPASGKETLR PAPLIITPDK  420
YSKKSSGLIC HSFETNENGS FICINDPSTS TCVDEGPNNS TEDYHLNDSK KLVPVNDFAS  480
LAEAKPHSLP KHETNMSSEQ HHEDMGASSS SLCFPSLDLP AFNDPVHDYS PLGIRKLLMS  540
SMACMSPLRL WESPTGKKTL VGAKSILRKR TRDLLTPLSE KRSDKKLETD IAASLAKDFS  600
RLDVMFDESE NQESISGMPE ETMDVSKSLV QPQQTCLEAN VQHAQSFSGV LSESNTNKQV  660
LSPPGQSVTK AEKTQVSTPR NHLQRTLMAT SNKEQHSPSS LCLVINSPSR ARNTESHLAN  720
NETNNENFSI FCGTPFRRGL ESPSAWKSPF YVNSLLPSPR FDTDITIEDM GYIFSPGERS  780
YESIGMFTQR HEHTSAFAAF NAMEISLSPS TDDAKKMKDL DKENNDPLMA EGRVLDFNDC  840
ESPTKXTEEV SSYLLKGM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-68371906159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-68371906159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3719750.0AF371975.2 Arabidopsis thaliana putative c-myb-like transcription factor MYB3R-4 (MYB3R4) mRNA, complete cds.
GenBankAY5196500.0AY519650.1 Arabidopsis thaliana MYB transcription factor (At5g11510) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013607014.10.0PREDICTED: LOW QUALITY PROTEIN: myb-related protein 3R-1
TrEMBLA0A0D3EG670.0A0A0D3EG67_BRAOL; Uncharacterized protein
STRINGBra008956.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM132131828
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.10.0myb domain protein 3r-4